Wasp venom evolution
نویسندگان
چکیده
منابع مشابه
Wasp venom allergy: effect of anti-IgE antibody on wasp venom anaphylaxis in a mouse model.
BACKGROUND Although anti-IgE antibody (Ab) therapy was recently shown to be effective in patients with bronchial asthma, no study has reported the effect of IgE therapy in the prevention of wasp venom anaphylaxis. In this study, we used a mouse model of wasp venom allergy to investigate the effect of anti-IgE Ab on wasp venom anaphylaxis. METHODS We developed a mouse model of wasp venom aller...
متن کاملPharmacological and Immunological Properties of Wasp Venom
Animal toxin envenomations have medical as well as ecological significance. Toxin-producing animals are categorized under either venomous group or poisonous group. Venomous animals are capable of producing and delivering the toxin during a biting or stinging act whereas poisonous animals are those whose tissues, either in whole or in part, are toxic. [1] About 75% of the world’s animal species ...
متن کاملHyposensitisation to wasp venom in six hours.
Eleven patients with a history of anaphylaxis, positive reactions to skin tests, and specific IgE antibody to wasp venom underwent hyposensitisation in a six hour procedure. No general reactions occurred. Complement activation and proteinuria could not be shown. The patterns of specific IgE, IgG1, and IgG4 were as described in other procedures--namely, IgE increased sharply and then decreased; ...
متن کاملA novel bioactive peptide from wasp venom
Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residue...
متن کاملPaulistine--The Functional Duality of a Wasp Venom Peptide Toxin.
It has been reported that Paulistine in the venom of the wasp Polybia paulista co-exists as two different forms: an oxidized form presenting a compact structure due to the presence of a disulfide bridge, which causes inflammation through an apparent interaction with receptors in the 5-lipoxygenase pathway, and a naturally reduced form (without the disulfide bridge) that exists in a linear confo...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
ژورنال
عنوان ژورنال: Science
سال: 2017
ISSN: 0036-8075,1095-9203
DOI: 10.1126/science.357.6348.264-a